Fluffy Chocolate Chip Pancakes - Easy Weekend Recipe
30-MINUTE MEALS! Get the email series now
Royal Recipe

Fluffy Chocolate Chip Pancakes

5 from 1 vote
1 Comments
Isabella Jane
By: Isabella JaneUpdated: May 18, 2026
This post may contain affiliate links. Please read our disclosure policy.

Light, tender pancakes studded with melty chocolate chips — an easy morning treat that turns ordinary weekends into celebrations.

Fluffy Chocolate Chip Pancakes

This stack of fluffy chocolate chip pancakes became my weekend ritual the moment I perfected the balance between tender crumb and those little pockets of melted chocolate. I first made this version on a rainy Saturday when the whole house smelled like warm butter and vanilla; the batter was simple, the method forgiving, and the result felt like a small celebration that fed everyone’s smile as much as their stomachs. They’re the kind of pancakes that coax sleepy kids out of bed and make grown-ups linger at the table. The texture is airy yet slightly custardy in the center, the edges golden and lightly crisp, and the chocolate chips offer just the right hit of indulgence without overpowering the batter.

I discovered a few technique tweaks over the years that elevated this basic mix to a reliable favorite: sifting the dry ingredients to trap air, not over-mixing the batter so the gluten stays relaxed, and using melted butter for depth of flavor. The recipe is forgiving enough to work when you’re rushed, but precise enough to reward a little patience. Serve warm with your favorite syrup or a dusting of powdered sugar — either way these pancakes feel like a hug on a plate. Keep a jar of good semisweet chips and some real unsalted butter on hand: they make a noticeable difference.

Why You'll Love This Recipe

  • Light and pillowy texture achieved with 2 1/2 teaspoons of aluminum-free baking powder and gentle mixing — ready in about 20 minutes from start to finish.
  • Uses pantry staples like all-purpose flour, milk, egg, and butter; chocolate chips add a kid- and adult-approved twist without extra fuss.
  • Easy to scale: the base batter doubles cleanly for a crowd, and leftovers reheat well in a toaster or oven without losing fluff.
  • Make-ahead option: batter holds in the fridge for up to 24 hours, allowing quick morning assembly for busy weekends or holiday brunches.
  • Crowd-pleaser for breakfast or dessert — pairs beautifully with fresh fruit, whipped cream, or a drizzle of pure maple syrup.
  • Technique-focused tips included so even novice cooks can achieve a bakery-quality finish at home.

My family’s reaction the first time I served this was immediate: unanimous approval and rushed requests for seconds. Over time I’ve played with chip varieties — semisweet, milk, or chopped dark chocolate — and watched the pancakes become the star of birthday breakfasts and sleepy Sunday brunches. There’s something comforting about the ritual of flipping each pancake and watching the bubbles form along the edges, signaling the perfect moment to turn.

Ingredients

  • All-purpose flour (1 1/2 cups): Use a reliable brand like King Arthur or Bob’s Red Mill for consistent protein content; spoon and level the flour rather than scooping to avoid compacting and heavy pancakes.
  • Baking powder (2 1/2 teaspoons, aluminum-free): Freshness matters — check the date. Aluminum-free gives a clean rise without metallic notes, producing a tender, airy crumb.
  • Salt (1/2 teaspoon): Balances sweetness and enhances the butter and chocolate flavors; use fine sea salt or kosher salt adjusted to taste.
  • Sugar (1 tablespoon): A touch of granulated sugar gives light caramelization at the edges and feeds the Maillard reaction for a golden crust.
  • Milk (1 1/4 cups): Whole milk yields the richest texture; 2% works fine for a slightly lighter batter. For a dairy-free option, substitute unsweetened almond or oat milk (see substitutions).
  • Egg (1 large): Adds structure and moisture; room temperature eggs blend more evenly into the batter, giving a smooth finish.
  • Butter, melted (3 tablespoons): Unsalted butter melted and cooled slightly contributes tenderness and flavor. If using salted butter, reduce the added salt slightly.
  • Chocolate chips (1/3 cup): Semisweet chips are my go-to for balance; use mini chips to distribute chocolate more evenly through each bite.

Instructions

Make the batter: In a large bowl, sift together the flour, baking powder, salt, and sugar. Sifting traps air and breaks up lumps so the finished texture is lighter. Create a well in the center and pour in the milk, egg, and melted butter. Whisk gently until the mixture is just combined; small lumps are okay — over-mixing develops gluten and yields dense pancakes. Fold in the chocolate chips last with a spatula to avoid overworking the batter. Let the batter rest 5 minutes while you heat the pan so the baking powder hydrates and the batter relaxes. Preheat the griddle: Heat a non-stick griddle or large skillet over medium to medium-high heat — about 375°F if your griddle has a thermostat. Lightly grease the surface with a little melted butter or cooking spray. To test readiness, flick a few drops of water onto the pan: they should dance and evaporate quickly but not burn. Cook the pancakes: Pour about 1/4 cup batter per pancake onto the hot griddle, leaving room to spread. Cook for roughly 1 1/2 to 2 minutes, watching for tiny bubbles across the surface and slightly set edges. Flip with a thin spatula and cook an additional 45 to 60 seconds until the other side is golden and the centers spring back when touched. Transfer finished pancakes to a warm plate or a low oven set to 200°F while you finish the batch. Serve and enjoy: Stack pancakes, add your favorite toppings, and serve immediately. For crisp edges, avoid covering the pancakes; for softer results, tent lightly with foil. Leftovers reheat well in a 350°F oven for a few minutes or in a toaster for single pancakes. User provided content image 1

You Must Know

  • These pancakes are best eaten the day they’re made, though the batter can chill up to 24 hours; chilled batter will be thicker — add a splash of milk to loosen before cooking.
  • Freezing cooked pancakes works well: layer between parchment and store in a zip-top bag for up to 2 months; reheat from frozen in a 350°F oven for 7–10 minutes.
  • High in carbohydrate and moderate in fat due to butter and chips; add fresh fruit or Greek yogurt to increase protein and fiber at the table.
  • Use room-temperature ingredients for even mixing and consistent rise; cold milk or egg can reduce oven spring and create dense spots.
  • Don’t skip the rest step — letting the batter sit improves hydration and produces a lighter texture.

My favorite part is that each pancake carries a little melt of chocolate in unexpected places — children love finding them, and adults appreciate the comforting familiarity. Once, at a holiday morning with extended family, I doubled the mix and everyone agreed these were the highlight of the meal; people even wrapped leftovers to take home. Those memories — buttery fingers and warm smiles — are why I keep this recipe in heavy rotation.

Storage Tips

Store any leftover cooked pancakes in an airtight container in the refrigerator for up to 3 days. To prevent condensation and sogginess, separate layers with sheets of parchment or paper towel. For longer storage, freeze single pancakes on a baking sheet until solid, then stack with parchment separators and transfer to a freezer-safe bag for up to 2 months. Reheat in a toaster for 1–2 cycles or in an oven at 350°F for 7–10 minutes; if reheating from frozen, add an extra minute or two. Avoid microwaving for extended periods as it can make the pancakes gummy. If you’ve prepared batter ahead, give it a gentle stir and add 1–2 tablespoons of milk if it thickened significantly before pouring onto the griddle.

Ingredient Substitutions

If you need dairy-free options, swap the milk for unsweetened almond or oat milk and use dairy-free margarine or coconut oil in place of the butter — expect a slightly different mouthfeel and flavor. For gluten-free pancakes, replace the flour with a 1-to-1 gluten-free blend that contains xanthan gum to mimic structure; the batter may be slightly more fragile. Honey or maple syrup can replace the tablespoon of sugar, but reduce any additional sweet toppings to avoid cloying sweetness. Use egg replacer or a flax egg (1 tablespoon ground flax mixed with 3 tablespoons water) for an egg-free version; the pancakes will be a touch denser but still satisfying. For chocolate, try chopped bittersweet chocolate or mini chips for even melting.

Serving Suggestions

Serve these pancakes warm with classic pure maple syrup and a pat of butter, or for a fresh contrast, top with sliced bananas, berries, and a dollop of lightly sweetened whipped cream. For brunch-worthy presentation, stack three pancakes, drizzle with warm chocolate sauce, and sprinkle toasted nuts for texture. A savory counterpoint like crisp bacon or smoked sausage pairs beautifully with the sweet chocolate, balancing the plate. For kids’ parties, offer a topping bar with sprinkles, fruit, and nut butters so guests can customize their stack. Garnish with a dusting of powdered sugar or a few extra chips for visual appeal.

User provided content image 2

Seasonal Adaptations

Brighten the batter in spring and summer by folding in grated lemon zest and fresh strawberries alongside the chips. In autumn, swap semisweet chips for chopped dark chocolate and add a teaspoon of cinnamon and a pinch of nutmeg to the dry mix for cozy spice notes; serve with poached pears or spiced apple compote. For winter holidays, stir in a tablespoon of espresso powder to deepen the chocolate flavor and top with candied orange peel. These small seasonal swaps transform the same basic method into festive variations for any time of year.

Success Stories

Readers often tell me this is the pancake they return to when feeding guests because it’s reliably fluffy and forgiving. One friend used this recipe to feed a houseful of teenagers after a sleepover — she tripled the batch and cooked on two griddles simultaneously; everything vanished. Another reader praised the make-ahead batter tip that saved her holiday morning when guests arrived early. Those stories remind me that simple, well-executed food creates the best memories.

Meal Prep Tips

Make a double batch on the weekend and freeze individual pancakes for weekday breakfasts: they reheat quickly and stay moist if toasted rather than microwaved. Portion out two pancakes per child into reusable containers and include a small container of yogurt or fruit for a balanced grab-and-go meal. If you prefer to prepare components the night before, mix dry ingredients and store separately; whisk wet ingredients together in the morning and combine for a truly speedy start. Label freezer bags with the date and number of pancakes to manage rotation.

These fluffy chocolate chip pancakes are a little ritual and a lot of comfort — simple to make, endlessly adaptable, and always welcome at the table. Make them your own, share them often, and enjoy the warm, buttery joy they bring to any morning.

Pro Tips

  • Sift dry ingredients to incorporate air for a lighter texture.

  • Use room-temperature milk and egg to mix more evenly and produce consistent rise.

  • Do not over-mix the batter; small lumps are okay and prevent toughness.

  • Preheat the griddle and test with a few drops of water before cooking.

  • Keep finished pancakes warm in a 200°F oven while you finish the batch.

This nourishing fluffy chocolate chip pancakes recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Why should I let the batter sit before cooking?

Let the batter rest for about 5 minutes to hydrate the flour and relax gluten; this results in lighter pancakes.

How long do leftovers keep?

Store cooked pancakes in an airtight container in the refrigerator for up to 3 days, or freeze up to 2 months separated with parchment.

Can I make these gluten-free?

Yes — use a 1-to-1 gluten-free flour blend that contains xanthan gum. Expect a slightly different texture.

Tags

Comfort Classicsbreakfastpancakesrecipesdessertfamily-friendlybrunch
No ratings yet

Fluffy Chocolate Chip Pancakes

This Fluffy Chocolate Chip Pancakes recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Fluffy Chocolate Chip Pancakes
Prep:10 minutes
Cook:15 minutes
Rest Time:10 mins
Total:25 minutes

Instructions

1

Combine dry ingredients

In a large bowl, sift together flour, baking powder, salt, and sugar to incorporate air and remove lumps.

2

Add wet ingredients

Make a well in the dry mix and pour in milk, egg, and melted butter; whisk gently until just combined. Small lumps are okay.

3

Fold in chocolate chips and rest

Stir in chocolate chips with a spatula, then let the batter rest 5 minutes to hydrate the flour and thicken slightly.

4

Preheat and test griddle

Heat a non-stick griddle over medium to medium-high heat (about 375°F). Grease lightly and test heat with a few drops of water.

5

Cook pancakes

Pour 1/4 cup batter per pancake, cook 1 1/2–2 minutes until bubbles form and edges set, flip and cook another 45–60 seconds until golden.

6

Keep warm and serve

Transfer pancakes to a warm plate or low oven while finishing the batch. Serve immediately with syrup or toppings.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 192kcal | Carbohydrates: 23g | Protein:
5g | Fat: 10g | Saturated Fat: 3g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
4g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@paletina on social media!

Fluffy Chocolate Chip Pancakes

Categories:

Fluffy Chocolate Chip Pancakes

Did You Make This?

Leave a comment & rating below or tag @paletina on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Isabella!

Chef and recipe creator specializing in delicious Comfort Classics cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.