Creamy White Chicken Enchilada Soup - Easy Recipe
30-MINUTE MEALS! Get the email series now
Royal Recipe

Creamy White Chicken Enchilada Soup

5 from 1 vote
1 Comments
Isabella Jane
By: Isabella JaneUpdated: Mar 22, 2026
This post may contain affiliate links. Please read our disclosure policy.

A cozy, creamy bowl of white chicken enchilada soup loaded with tender shredded chicken, white beans, corn, and tangy green chiles—ready in under an hour.

Creamy White Chicken Enchilada Soup
This creamy white chicken enchilada soup has been my go-to when I want something comforting, quick, and full of bright southwestern flavors. I discovered this combination on a busy weeknight when a rotisserie chicken sat waiting in my fridge and a drawer full of pantry staples begged to be used. The enchilada sauce and green chiles give it familiar enchilada notes while the cream cheese and Monterey Jack add a velvet finish that turns a simple soup into something indulgent yet approachable. It’s the sort of dish that fills the kitchen with an aroma that draws everyone to the table. I remember serving this to friends on a cold evening and watching skeptical visitors take a cautious first spoonful—only to go back for seconds within minutes. The texture is what sells it: tender shredded chicken, creamy beans, and pops of corn, all suspended in a lush, slightly spicy broth that clings to tortilla strips and avocado alike. It’s flexible for what you have on hand and kind enough to be a crowd-pleaser. Make it with rotisserie chicken for the fastest turnaround, or prep your own shredded breasts ahead of time for meal-prep friendly lunches.

Why You'll Love This Recipe

  • The soup comes together quickly: ready from fridge to bowl in about 40 minutes when you use pre-cooked chicken, making it perfect for weeknights and last-minute guests.
  • It leans on pantry staples—canned beans, corn, enchilada sauce—so you can usually make it without a trip to the store. Fresh additions like cilantro and avocado are optional but elevate the final bowl.
  • Cream cheese and Monterey Jack create a smooth, melt-in-your-mouth finish that still feels light compared with heavy cream; the lime juice brightens the whole pot at the end.
  • Adaptable to heat preferences: use pepper jack for a spicy kick, or mild Monterey Jack to keep it family-friendly. Add sliced jalapeños or hot sauce at the table instead of in the pot for more control.
  • Great for make-ahead and freezing: freezes well in portions for busy weeks and reheats beautifully on the stovetop or in the microwave.
  • Balanced and filling without being heavy—the beans add fiber and the chicken adds protein so it satisfies on its own or alongside a crisp salad.

I’ve watched picky eaters become converts because the flavors are familiar but slightly elevated. A simple trick I learned: warm the enchilada sauce briefly before adding it so it incorporates seamlessly into the broth. That alone improves texture and flavor integration.

Ingredients

  • Olive oil: 2 tablespoons. Use a good extra-virgin olive oil for flavor; it provides the initial frying medium for the onion and helps bloom the spices.
  • Yellow onion: 1 medium, diced. Look for a firm onion with no soft spots; the onion forms the aromatic base and softens to sweetness when sautéed.
  • Garlic: 3 cloves, minced. Fresh garlic adds brightness—use a microplane or fine mince so it disperses evenly through the soup.
  • Spices: 1 teaspoon cumin, 1 teaspoon chili powder, 1 teaspoon smoked paprika. Measured spices deliver the chili-enchilada profile; toast briefly in the oil to release essential oils.
  • Chicken broth: 4 cups. Low-sodium is recommended so you can control seasoning; chicken broth is the body of the soup and should be flavorful.
  • Chicken: 2 cups cooked, shredded (rotisserie or cooked breasts). Rotisserie adds extra depth from roasting; if using breasts, poach or roast and shred for the best texture.
  • White beans: 2 cans (15-ounce each), drained and rinsed. Cannellini or great northern beans add creaminess and fiber—rinse to remove canned saltiness.
  • Corn: 1 can (15-ounce), drained. Adds sweetness and texture contrast; fresh or frozen corn may be used (about 1 1/4 cups fresh or frozen).
  • Green chiles: 2 cans (4-ounce each), diced. Mild heat and tang; choose mild or hot depending on preference.
  • Green enchilada sauce: 1 can (10-ounce). This gives the signature enchilada flavor—check the label for gluten if sensitive.
  • Cream cheese: 1 block (8-ounce), cubed and softened. Softened cream cheese blends smoothly to create the soup’s creamy texture; let it sit at room temperature 15 minutes before use.
  • Monterey Jack cheese: 1 1/2 cups shredded (about 6 ounces). Use pepper jack if you want more heat; grate your own for quicker melting and better texture.
  • Lime: Juice of 1 lime. Adds acidity to balance the richness and lift the flavors at the end.
  • Salt and pepper: To taste. Adjust carefully because canned ingredients and cheese contribute sodium.
  • Optional toppings: Chopped cilantro, sliced jalapeños, diced avocado, and crunchy tortilla strips. These offer texture and fresh contrast when serving.

Instructions

Sauté aromatics: Heat 2 tablespoons of olive oil in a large heavy-bottomed pot over medium heat. Add the diced onion and cook until translucent and soft, about 3 to 4 minutes, stirring occasionally so it browns evenly. Add the minced garlic and the measured spices—1 teaspoon each cumin, chili powder, and paprika—and cook for 30 to 60 seconds until fragrant. Toasting the spices in oil releases their essential oils and deepens flavor. Build the base: Add 2 cups shredded cooked chicken, both drained cans of white beans, drained corn, two 4-ounce cans of diced green chiles, the 10-ounce can of green enchilada sauce, and 4 cups chicken broth. Stir to combine and bring the pot to a gentle simmer over medium-low heat. Taste the broth and adjust heat so it stays at a low simmer to avoid breaking the dairy later. Add creaminess: Reduce heat to low and add the cubed 8-ounce cream cheese a few pieces at a time, stirring after each addition to encourage melting. Keep the heat low—cream cheese can separate if cooked too vigorously. Stir patiently until the cream cheese is fully incorporated and the liquid appears smooth and velvety. Incorporate cheese: Stir in 1 1/2 cups shredded Monterey Jack cheese, a handful at a time, until it melts into the soup. If you prefer a silkier finish, use an immersion blender for a few quick pulses—leave some beans whole for texture. Avoid overheating the soup once the cheese is added to prevent graininess. Simmer and finish: Let the soup simmer gently for 15 to 20 minutes, stirring occasionally. This melds flavors and ensures the beans are warmed through. Taste and season with salt and black pepper as needed. Remove from heat and stir in the juice of one lime to brighten the pot right before serving. Serve: Ladle into bowls and top with chopped cilantro, diced avocado, sliced jalapeños, and crunchy tortilla strips as desired. Serve with warm corn or flour tortillas for dipping. Creamy White Chicken Enchilada Soup in a bowl with toppings

You Must Know

  • This recipe yields about six generous bowls and stores well refrigerated for 3 to 4 days; freeze in airtight containers for up to 3 months.
  • It’s high in protein thanks to chicken and white beans, and the beans add fiber for a filling meal. Adjust salt to account for canned ingredients and cheese.
  • If using low-sodium broth and rinsing beans, control the final salt level more precisely and avoid oversalting early in cooking.
  • To keep the texture stable, melt dairy over low heat and avoid a rolling boil once cream cheese or shredded cheese is added.

My favorite aspect is how adaptable it is—this pot has fed late-night study groups, family dinners, and solo lunches. One memorable version included roasted poblanos instead of the canned chiles and a squeeze of fresh orange in place of lime for a sweeter, smokier twist. Every time I make it, someone asks for the recipe, and it’s now a staple whenever a cold evening calls for comfort with a bit of kick.

Spoon lifting creamy white chicken enchilada soup with cilantro and avocado

Storage Tips

Cool leftover soup to room temperature within two hours, then transfer to airtight containers and refrigerate for up to 4 days. For freezing, portion into meal-sized containers leaving 1/2 inch headspace and freeze up to 3 months. To reheat, thaw overnight in the refrigerator and warm gently on the stovetop over low heat to avoid separating the dairy; add a splash of broth or water if it appears too thick. Reheat in the microwave in short bursts, stirring between intervals, and finish with a squeeze of lime to refresh the flavors.

Ingredient Substitutions

If you need to swap ingredients, use plain Greek yogurt or silken tofu for part of the cream cheese to reduce saturated fat—temper Greek yogurt by whisking a small amount of hot soup into it before stirring back into the pot. Substitute black beans if you prefer a darker bean and expect a different visual contrast but similar protein and fiber. For a vegetarian version, replace chicken with extra beans and roasted cauliflower, and use vegetable broth. For gluten-free assurance, choose a labeled gluten-free enchilada sauce, as some store-bought sauces may contain additives with gluten.

Serving Suggestions

Serve with bright accompaniments: diced avocado, chopped cilantro, lime wedges, sliced jalapeños, and crispy tortilla strips. A simple side salad with peppery arugula and a citrus vinaigrette balances the creaminess, while warm corn tortillas are perfect for dipping. For a heartier spread, offer Mexican rice and a bowl of pickled red onions to cut through the richness. Garnishes can be laid out buffet-style so guests customize heat and texture.

Cultural Background

This pot borrows from southwestern and Mexican-American flavors—enchilada sauce and green chiles evoke classic enchilada fillings, while the creamy adaptation is a contemporary American comfort twist. Historically, enchiladas are a Mexican dish of rolled tortillas filled with meat or cheese and smothered in sauce; this soup captures those same flavor elements in a rustic, slurpable form that suits cold-climate comfort food traditions.

Seasonal Adaptations

In summer, swap canned corn for grilled fresh corn and use fire-roasted green chiles for smoky depth. In winter, add diced roasted sweet potatoes or butternut squash for a heartier seasonal base and finish with toasted pumpkin seeds for crunch. Holiday versions can include chopped roasted poblano peppers and a sprinkle of smoked salt for a celebratory twist.

Meal Prep Tips

Make a double batch and freeze individual portions for quick weeknight dinners. Keep toppings separate—store avocado and tortilla strips fresh at serving time to preserve texture. Shred the chicken and measure spices ahead of time, storing them in labeled containers so you can build the pot in under 20 minutes on a busy night.

This soup is the sort of recipe that welcomes improvisation and rewards small technique choices—low heat for dairy, a final squeeze of lime, and freshly grated cheese make all the difference. Serve it to friends, pack it for lunches, or enjoy a quiet bowl with extra cilantro; it always feels like a warming, clever spin on two classic cuisines.

Pro Tips

  • Soften the cream cheese to room temperature before adding so it melts evenly without clumping.

  • Toast the spices briefly in the hot oil to release more flavor before adding liquids.

  • Rinse canned beans to remove excess sodium and canned flavor, which helps control the final seasoning.

  • If the soup becomes grainy after reheating, whisk in a small splash of warm broth off heat to smooth it out.

This nourishing creamy white chicken enchilada soup recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

How long does leftover soup keep?

Yes. Store leftover soup in an airtight container in the refrigerator for up to 4 days. Reheat gently on the stovetop and add a splash of broth if too thick.

Can I use leftover or pre-cooked chicken?

Use rotisserie chicken for speed, or poach chicken breasts in seasoned water for 15 minutes, then shred. You can also use leftover roasted chicken.

Tags

Comfort Classicssoupchickencreamyenchiladadinnerweeknightsouthwestern
No ratings yet

Creamy White Chicken Enchilada Soup

This Creamy White Chicken Enchilada Soup recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Creamy White Chicken Enchilada Soup
Prep:15 minutes
Cook:25 minutes
Rest Time:10 mins
Total:40 minutes

Ingredients

Main

Optional Toppings

Instructions

1

Sauté aromatics

Heat 2 tablespoons of olive oil over medium heat in a large pot. Add the diced onion and cook 3 to 4 minutes until softened. Add minced garlic and spices (1 teaspoon each cumin, chili powder, paprika) and cook 30–60 seconds until fragrant, stirring constantly to avoid burning.

2

Build the base

Add 2 cups shredded cooked chicken, drained white beans, drained corn, diced green chiles, green enchilada sauce, and 4 cups chicken broth. Stir to combine and bring to a gentle simmer over medium-low heat.

3

Add creaminess

Reduce heat to low and add cubed cream cheese a few pieces at a time, stirring until completely melted and smooth. Keep the heat low to prevent separation.

4

Incorporate cheese

Stir in 1 1/2 cups shredded Monterey Jack cheese gradually until melted and fully blended into the soup. Optionally pulse a few times with an immersion blender for a smoother texture.

5

Simmer

Let the soup simmer gently for 15 to 20 minutes, stirring occasionally so flavors meld and the soup heats through evenly.

6

Season and finish

Taste and adjust seasoning with salt and pepper. Remove from heat and stir in the juice of 1 lime to brighten flavors before serving.

7

Serve

Ladle into bowls and garnish with chopped cilantro, sliced jalapeños, diced avocado, and tortilla strips as desired.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 420kcal | Carbohydrates: 28g | Protein:
32g | Fat: 30g | Saturated Fat: 9g |
Polyunsaturated Fat: 6g | Monounsaturated Fat:
12g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@paletina on social media!

Creamy White Chicken Enchilada Soup

Categories:

Creamy White Chicken Enchilada Soup

Did You Make This?

Leave a comment & rating below or tag @paletina on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Isabella!

Chef and recipe creator specializing in delicious Comfort Classics cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.