Quick Sweet Potato Brussel Sprout Hash - Easy Weekday
30-MINUTE MEALS! Get the email series now
Royal Recipe

Quick Sweet Potato Brussels Sprout Hash

5 from 1 vote
1 Comments
Isabella Jane
By: Isabella JaneUpdated: Jul 16, 2026
This post may contain affiliate links. Please read our disclosure policy.

A fast, crispy skillet hash of sweet potatoes and Brussels sprouts — versatile for breakfast, lunch, or an easy weeknight dinner with optional proteins and vibrant toppings.

Quick Sweet Potato Brussels Sprout Hash
This skillet hash of sweet potato and Brussels sprouts became my go-to when I needed something fast, filling, and a little different from the usual egg-and-toast mornings. I first put these two together on a rainy Saturday when the market had beautiful, tight Brussels sprouts and a single oversized sweet potato tucked into my bag. The combination surprised me: the sweet, tender cubes of sweet potato against the caramelized, slightly nutty pull of halved Brussels sprouts produced a texture interplay I hadn’t expected. It’s crisp where you want it and tender throughout, with the smoked paprika adding just enough warmth to make the dish feel like comfort food without weighing you down. Over the years I’ve made this on hectic weekday mornings and for leisurely weekend brunches. My partner swears it’s the best way to eat Brussels sprouts — crispy edges, soft centers, and those sweet spots where the potato caramelizes. The basic version is vegetarian and dairy-free, but it also plays beautifully with bacon or sausage for a more indulgent breakfast or tofu for a protein-forward lunch. This is the sort of dish that’s forgiving: misjudge the timing and it’s still delicious; add an egg, and it becomes a full meal. The aroma while it cooks is bright with smoked paprika and thyme, and my kitchen always feels like it’s putting on a show.

Why You'll Love This Recipe

  • Fast and flexible — ready in about 30 minutes from start to finish, perfect for weeknights and last-minute brunch guests.
  • Simple pantry and market ingredients — uses a single sweet potato, a small bag of Brussels sprouts, and common seasonings you likely already own.
  • Versatile protein options — easily add bacon, turkey sausage, tofu, or eggs to suit dietary preferences and make it heartier.
  • Great make-ahead and meal prep — cooks well in batches and reheats beautifully for breakfasts or lunches through the week.
  • Textural contrast — crisp caramelized edges and tender inner bites make every forkful interesting without complicated techniques.

I’ve watched picky eaters fall for the crispy bits and seen leftovers reinvented as a filling sandwich with avocado slices. My favorite memory is serving this at a small brunch where everyone asked for seconds and someone requested I package the leftovers to take home. It’s a straightforward winner when people want something honest and satisfying.

Ingredients

  • Sweet potatoes (2 cups diced, about 1 large): Choose firm sweet potatoes with smooth skin; they caramelize well and hold shape when diced. I like Beauregard or Garnet varieties for their natural sweetness and texture.
  • Brussels sprouts (2 cups trimmed and halved): Look for small, compact sprouts with bright green leaves. Trimming the base and removing any loose outer leaves helps them brown evenly and prevents bitterness.
  • Olive oil or avocado oil (1 tablespoon): Use a high-heat oil — avocado oil tolerates higher temperatures for crisping; extra-virgin olive oil adds flavor at medium heat.
  • Smoked paprika (1 teaspoon): Adds a gentle smokiness that pairs beautifully with the sweet potato. Use Spanish smoked paprika (pimentón) if you have it.
  • Garlic powder (1 teaspoon) and onion powder (1/2 teaspoon): These give a steady savory backbone without the moisture of fresh garlic; they caramelize with the vegetables.
  • Dried thyme (1/2 teaspoon): A subtle herbaceous note that brightens the hash; fresh thyme can be added at the end for freshness.
  • Salt (1/2 teaspoon) and black pepper (1/4 teaspoon): Season to taste; coarse salt helps draw moisture for better caramelization.
  • Optional vegetables — onion and bell pepper (each 1/2 cup diced): Red onion and a sweet bell pepper add color and sweetness; they’re optional but welcome.
  • Optional add-ins: 4 slices cooked bacon chopped, 1/2 pound turkey or breakfast sausage, 1 cup tofu cubes, or 2–4 eggs for serving.
  • Toppings: Fresh parsley or chives, avocado slices, and a few dashes of hot sauce make great finishing touches.

Instructions

Step 1 — Prep the vegetables: Peel (if you prefer) and cut the sweet potato into small, even 1/2-inch cubes so they cook at the same rate. Trim the Brussels sprouts, remove any loose leaves, and halve them through the core. Dice the onion and bell pepper into similar-sized pieces if using. Uniform size is the key to even cooking and crisp edges. Step 2 — Heat the skillet: Place a large skillet over medium heat and warm the oil until it shimmers but does not smoke. A 10–12-inch cast-iron skillet works best for surface contact and deep browning; nonstick is fine for easy cleanup but gives less crust. Step 3 — Start the sweet potatoes: Add the diced sweet potatoes in a single layer and let them cook for 8–10 minutes, stirring occasionally. Letting them sit undisturbed for 2–3 minutes at a time encourages caramelization. Look for golden-brown edges and a fork-tender center. Step 4 — Add Brussels sprouts and aromatics: Stir in the halved sprouts, diced onion, and bell pepper. Sprinkle the smoked paprika, garlic powder, onion powder, thyme, salt, and pepper over the vegetables, tossing to coat. Reduce heat slightly if the pan browns too quickly. Step 5 — Crisp and finish cooking: Continue to cook for another 10–12 minutes, stirring every few minutes. Avoid overcrowding the pan; if necessary, cook in batches. The goal is caramelized edges and tender insides — test a sweet potato cube for doneness and a Brussels sprout for a tiny bit of resistance. Step 6 — Add proteins if using: If adding chopped cooked bacon or cooked sausage, stir it in during the last 5 minutes to warm through. For tofu, sear the cubes separately until golden then fold in. To add eggs, make 2–4 wells in the hash, crack eggs into the wells, cover, and cook 4–6 minutes for runny yolks or longer for firmer yolks. Step 7 — Serve: Remove from heat, taste and adjust seasoning, then garnish with chopped parsley or chives, avocado slices, and hot sauce if desired. Serve immediately so the crispy edges stay crisp. User provided content image 1

You Must Know

  • This dish stores well in the refrigerator up to 4 days and freezes for up to 3 months in a sealed container; thaw and re-crisp in a hot skillet.
  • High in fiber and vitamins from sweet potatoes and Brussels sprouts; adding a protein boosts satiety for a balanced meal.
  • Skillet size matters: using a large pan prevents steaming and helps develop those coveted crispy edges.
  • Sausage and bacon variants can increase sodium and fat — choose lean turkey sausage or tofu to control calories.

My favorite part of this dish is the flexibility — I’ll make a double batch on Sunday to fuel weekday breakfasts, and sometimes I use the leftovers as a filling for warm tortillas. A simple fried egg transforms the mix into a decadent, comforting plate that feels like a treat even on a busy morning.

User provided content image 2

Storage Tips

Store cooled leftovers in an airtight container in the refrigerator for up to 4 days. To reheat, warm a skillet over medium-high heat with a teaspoon of oil and sauté the hash for a few minutes to restore crispness rather than microwaving, which can make it soggy. For freezing, spread the hash on a baking sheet to flash-freeze for 30–60 minutes, then transfer to a freezer bag; this prevents clumping. Thaw overnight in the fridge and re-crisp in a skillet or roast at 400°F for 10–12 minutes.

Ingredient Substitutions

If you don’t have sweet potatoes, use 2 cups of butternut squash or regular potatoes — note that white potatoes will take slightly longer to soften. Swap smoked paprika for a pinch of chili powder plus regular paprika if you prefer milder heat. For a lower-fat option, skip the oil by using a nonstick pan and a few tablespoons of vegetable stock to prevent sticking while still encouraging browning. If you want extra green, fold in a handful of spinach at the end; it wilts quickly and adds color and nutrients.

Serving Suggestions

Serve with a runny fried or poached egg on top and sliced avocado for creaminess. For a heartier brunch, add a side of toasted sourdough or a simple mixed green salad with lemon vinaigrette. At dinner, plate it alongside roasted chicken or pan-seared salmon. Garnish ideas include chopped parsley, chives, a squeeze of lemon, or a drizzle of your favorite hot sauce to brighten the flavors.

Cultural Background

Skillet hashes have roots in rustic home cooking where simple ingredients are transformed with high heat and time-tested technique. Combining root vegetables and cruciferous greens mirrors classic farmer’s-market cooking, where seasonality dictated flavors. While not tied to a single regional cuisine, this version embraces modern American brunch sensibilities — bold spices, quick cooking, and customizable add-ins that reflect diverse influences.

Seasonal Adaptations

Autumn and winter are perfect for this dish when sweet potatoes and Brussels sprouts are at their peak. In spring, swap in young new potatoes and asparagus tips for a lighter version. For the holidays, stir in a handful of toasted pecans and a splash of maple syrup for a sweeter side. Summer calls for bell peppers and fresh herbs like basil and cilantro to brighten the skillet.

Meal Prep Tips

Make a double batch on Sunday for quick weekday breakfasts. Portion into microwave- and oven-safe containers for grab-and-go meals. If you plan to add eggs each morning, reserve a pan of hash only and fry eggs fresh to keep yolks runny. Alternatively, roast two sheet pans at once to speed cooking: one with sweet potatoes and one with Brussels sprouts and aromatics, then combine and finish in the skillet.

Give this one a try the next time you want something fast, wholesome, and full of character — it’s a small bit of kitchen magic that turns simple produce into something you’ll want again and again.

Pro Tips

  • Cut vegetables to uniform sizes so everything cooks evenly and the sweet potatoes and Brussels sprouts finish at the same time.

  • Use a cast-iron skillet or a heavy-bottomed pan to maximize surface browning and crisp edges.

  • Avoid overcrowding the pan; cook in batches if necessary to prevent steaming and promote caramelization.

  • For runny eggs, make wells in the hash, cover the skillet, and check after 4–6 minutes to reach desired doneness.

  • To re-crisp leftovers, reheat in a skillet over medium-high heat with a splash of oil rather than microwaving.

This nourishing quick sweet potato brussels sprout hash recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Skillet Meals breakfasthashvegetarianweeknight-mealpotatoesbrussels-sprouts
No ratings yet

Quick Sweet Potato Brussels Sprout Hash

This Quick Sweet Potato Brussels Sprout Hash recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Quick Sweet Potato Brussels Sprout Hash
Prep:10 minutes
Cook:20 minutes
Rest Time:10 mins
Total:30 minutes

Ingredients

Hash

Optional Add-Ins

Optional Toppings

Instructions

1

Prep the Vegetables

Peel (optional) and dice the sweet potato into roughly 1/2-inch cubes. Trim and halve the Brussels sprouts and dice the onion and bell pepper to similar sizes so everything cooks evenly.

2

Heat the Skillet

Warm 1 tablespoon of oil in a 10–12 inch skillet over medium heat until shimmering. Cast iron is preferred for best browning and crisping.

3

Cook the Sweet Potatoes

Add diced sweet potatoes in a single layer and cook 8–10 minutes, stirring occasionally. Allow them to sit undisturbed for 2–3 minutes at a time to develop golden edges.

4

Add Brussels Sprouts and Seasonings

Add halved Brussels sprouts, onion, and bell pepper. Sprinkle smoked paprika, garlic powder, onion powder, thyme, salt, and pepper. Toss to coat evenly and reduce heat if needed.

5

Crisp and Cook Through

Continue cooking 10–12 minutes, stirring every few minutes so vegetables caramelize and become tender. Avoid overcrowding the pan; cook in batches if necessary.

6

Add Optional Proteins

Stir in chopped cooked bacon or sausage during the last 5 minutes to warm. For tofu, sear separately and fold in. For eggs, make wells in the hash, crack eggs in, cover, and cook to desired doneness.

7

Serve

Remove from heat, adjust seasoning, and garnish with herbs, avocado slices, or hot sauce. Serve immediately to enjoy crispy edges.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 230kcal | Carbohydrates: 35g | Protein:
4g | Fat: 8g | Saturated Fat: 2g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
3g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@paletina on social media!

Quick Sweet Potato Brussels Sprout Hash

Categories:

Quick Sweet Potato Brussels Sprout Hash

Did You Make This?

Leave a comment & rating below or tag @paletina on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Isabella!

Chef and recipe creator specializing in delicious Skillet Meals cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.