Creamy Green Chicken Enchilada Soup - Cozy Weeknight
30-MINUTE MEALS! Get the email series now
Royal Recipe

Creamy Green Chicken Enchilada Soup

5 from 1 vote
1 Comments
Isabella Jane
By: Isabella JaneUpdated: Mar 22, 2026
This post may contain affiliate links. Please read our disclosure policy.

A cozy, tangy, and creamy enchilada-inspired soup made with green enchilada sauce, white beans, corn, and shredded chicken—comfort in a bowl.

Creamy Green Chicken Enchilada Soup

This creamy green chicken enchilada soup became a household favorite the first time I made it on a blustery evening when the pantry was half-full and my goal was something fast, warming, and satisfying. The bright tang of green enchilada sauce combined with the mellow richness of cream cheese creates a silky base that wraps around hearty white beans, sweet corn, and tender shredded chicken. I discovered this balance while experimenting with rotisserie chicken and a jar of green sauce; what started as a quick idea turned into a recipe that guests ask me to make whenever they need something comforting and a little different.

What makes this pot special is the contrast of textures and flavors: soft white beans that thicken the broth, sweet bursts of corn, and the smoky undertone from cumin and smoked paprika. It’s an easy, weeknight-friendly dish that also travels well to potlucks or busy weekend lunches. My family loves piling on toppings — cilantro, creamy avocado, a squeeze of lime — which transforms each bowl into a personal, vibrant meal. Every spoonful brings together tang, creaminess, and a touch of heat in a way that feels both homey and celebratory.

Why You'll Love This Recipe

  • Ready in under 40 minutes from start to finish, making it ideal for busy weeknights without sacrificing depth of flavor.
  • Uses pantry staples like canned beans, canned corn, and jarred enchilada sauce, so you can pull it together even when the fridge is sparse.
  • Rotisserie chicken speeds things up and adds rich, roasted flavor; the soup also freezes well for make-ahead meals.
  • Cream cheese provides a silky mouthfeel without heavy cream, keeping the broth luscious while blending easily into the sauce.
  • Customizable toppings let each person tailor their bowl — from crunchy tortilla strips to cooling avocado and lime — making it a crowd-pleaser.
  • Comforting but bright: tangy green sauce and warm spices make this a next-level soup that feels festive yet simple.

In my kitchen this one has become a shortcut to joy — I first brought it to a small family gathering and watched a usually picky cousin go back for seconds. It’s the recipe I reach for when cravings call for something both homey and a little bit zesty, and it never disappoints.

Ingredients

  • Olive oil (1 tablespoon): A neutral, fruity extra virgin variety works well; it helps sauté the onion and builds the base flavor without overpowering the green sauce.
  • Onion (1 medium, chopped): Yellow or sweet onion; sweated until softened to add natural sweetness and depth. I prefer a medium Vidalia-style for balanced flavor.
  • Chicken broth (3 cups): Use low-sodium if you plan to salt to taste — it allows better control. Good-quality boxed or homemade stock will elevate the finishing taste.
  • Green enchilada sauce (2 x 15-ounce cans): I use mild for family-friendly heat; brands like Hatch or Ortega give consistent tangy flavor. This is the bright backbone of the soup.
  • White beans (2 x 14-ounce cans, drained & rinsed): Cannellini or Great Northern beans both work; they help thicken and add creaminess and plant-based protein to the pot.
  • Corn (1 x 12-ounce can, drained): Adds sweetness and bite; fire-roasted corn gives an extra smoky edge if available.
  • Green chilies (2 x 4-ounce cans, mild): Adds gentle heat and oniony green pepper flavor; drain but reserve a little juice if you like an extra punch.
  • Spices: Chili powder (1 tbsp), garlic powder (1 tsp), ground cumin (1 tsp), smoked paprika (1 tsp), dried oregano (1/2 tsp) — these season the broth and give smoky, earthy notes.
  • Cream cheese (4 ounces, softened): Bring to room temperature or microwave briefly to blend smoothly into the soup for that signature creamy texture.
  • Cooked chicken (2 cups shredded): Rotisserie chicken is my go-to for speed and flavor; about 2 cups shredded yields tender, flavorful bites throughout the soup.
  • Salt & pepper: To taste; adjust at the end after the cream cheese is incorporated so you don't over-salt.
  • Toppings (optional): Shredded Mexican cheese blend, cilantro, sliced avocado, lime wedges, and tortilla strips add texture, brightness, and crunch.

Instructions

Sauté the aromatics: Heat 1 tablespoon olive oil in a Dutch oven or heavy soup pot over medium-high heat. Add the chopped onion and sauté until softened and beginning to brown, about 5–7 minutes. Browning the onion develops sweet, caramelized notes that balance the tang of the green sauce. Combine liquids and cans: Pour in 3 cups chicken broth, 2 cans of green enchilada sauce, drained white beans, drained corn, and both cans of green chilies. Stir in the chili powder, garlic powder, ground cumin, smoked paprika, and dried oregano. Bring the mixture to a gentle boil over high heat, stirring to incorporate the spices evenly. Simmer briefly: Once boiling, reduce the heat to maintain a gentle simmer with the lid slightly ajar for 5 minutes. This short simmer melds the flavors and heats the beans and corn through while keeping the sauce bright. Soften and add the cream cheese: Cut 4 ounces of cream cheese into smaller pieces and microwave in 20–30 second intervals until very soft. Stir the softened cream cheese into the simmering soup until fully melted and smooth — this creates a velvety texture and tames some of the sauce's acidity. Finish with chicken: Fold in 2 cups shredded cooked chicken and continue to simmer for another 5 minutes so the chicken warms through and absorbs flavor. Taste and season with salt and freshly ground pepper as needed. Serve with toppings: Ladle into bowls and offer toppings like shredded cheese, chopped cilantro, sliced avocado, lime wedges, and tortilla strips. Each topping adds a layer — bright, creamy, or crunchy — to complete the bowl. User provided content image 1

You Must Know

  • The recipe freezes well for up to 3 months; cool completely before transferring to freezer-safe containers and leave headspace for expansion.
  • This is high in protein from both chicken and white beans, and the beans also help thicken the broth naturally without flour or cornstarch.
  • Use low-sodium broth if you plan to salt generously at the end — enchilada sauce and canned beans can add unexpected sodium.
  • Swapping rotisserie for leftover baked chicken won't change texture much; shred warm chicken for the best integration into the soup.
  • If you prefer a spicier bowl, use medium green enchilada sauce or add a splash of the reserved green chilies juice.

One of my favorite things about this bowl is how forgiving it is — I’ve made it with whatever was on hand and it always came out comforting. At a small dinner party, guests loved customizing their bowls; the colorful toppings made it feel like a festive, interactive meal. The soup’s warmth and layered flavors turned a casual weeknight into something memorable.

User provided content image 2

Storage Tips

Store leftovers in airtight containers in the refrigerator for up to 4 days. If planning to freeze, cool the soup completely and transfer to freezer-safe containers or heavy-duty freezer bags; it keeps well for about 3 months. Thaw overnight in the refrigerator before reheating. Reheat on the stovetop over medium-low heat, stirring frequently to reincorporate any separated cream cheese; a splash of broth will loosen the texture if it becomes too thick. For best texture, add fresh toppings after reheating rather than before storing.

Ingredient Substitutions

If you don’t have canned green enchilada sauce, substitute with 2 cups of salsa verde plus a squeeze of lime and a pinch more cumin to mimic the profile. Swap cream cheese for 1/2 cup heavy cream for a looser texture or for a dairy-free option use 4 ounces of a plant-based cream cheese and set is_dairy_free accordingly. Pinto beans can replace white beans for a slightly earthier taste, and frozen corn is a fine alternative to canned; drain well if using canned to avoid diluting the broth.

Serving Suggestions

Serve hot with a variety of textures: crunchy tortilla strips or baked tortilla chips, a sprinkle of shredded Mexican cheese blend, and cooling diced avocado or crema. A wedge of lime brightens the bowl. For heartier fare, offer warm flour tortillas or cornbread on the side. For a lighter meal, pair a modest bowl with a crisp green salad dressed in citrus vinaigrette to contrast the soup’s creaminess.

Cultural Background

This dish is a Tex-Mex inspired interpretation that pulls from Mexican green sauce traditions, particularly salsa verde and green enchilada sauces rooted in roasted tomatillos and chiles. The combination of beans, corn, and shredded chicken echoes classic homestyle preparations across Northern Mexico and the American Southwest, where canned sauces and convenience ingredients have long been adapted into comforting one-pot meals. This recipe celebrates those flavors while leaning into the quick, family-friendly approach common in contemporary home cooking.

Seasonal Adaptations

In summer, swap canned corn for fresh grilled corn and add chopped fire-roasted tomatoes for brightness. In winter, include a handful of chopped kale or spinach at the end to boost greens and nutrition. For holiday gatherings, serve in small ramekins topped with pickled jalapeños and micro cilantro for a festive starter. Adjust spice levels seasonally — cooler months welcome a smokier profile with extra smoked paprika, while spring favors lighter, citrus-forward garnishes.

Meal Prep Tips

Make a double batch and freeze half for busy weeks. Keep toppings separate and package them in small containers so the reheated soup stays fresh and textures remain distinct. If preparing for lunches, portion into microwave-safe containers and reheat with a splash of broth to restore creaminess. Pre-shredded chicken can be stored in the fridge for up to 3 days and added at the last minute to prevent drying out.

This bowl is one of those recipes that grows more beloved with each serving — simple to scale, forgiving with substitutions, and endlessly customizable. I hope it becomes a staple in your rotation as it has in mine; there’s something deeply satisfying about a bowl that comforts, feeds a crowd, and still feels a little bit special.

Pro Tips

  • Soften the cream cheese before adding to ensure a smooth, velvety broth without lumps.

  • Use low-sodium broth to better control the final seasoning; add salt at the end after tasting.

  • Rotisserie chicken speeds up prep and adds roasted flavor, but leftover roasted chicken works just as well.

  • If freezing, under-salt before freezing and adjust seasoning after thawing and reheating.

This nourishing creamy green chicken enchilada soup recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Comfort Classicssoupchickenenchiladacreamyrecipeweeknight
No ratings yet

Creamy Green Chicken Enchilada Soup

This Creamy Green Chicken Enchilada Soup recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Creamy Green Chicken Enchilada Soup
Prep:10 minutes
Cook:20 minutes
Rest Time:10 mins
Total:30 minutes

Instructions

1

Sauté the aromatics

Heat 1 tablespoon olive oil in a Dutch oven over medium-high heat. Add the chopped onion and sauté until softened and lightly browned, about 5–7 minutes, to develop sweetness and depth.

2

Add liquids and canned ingredients

Stir in 3 cups chicken broth, both cans of green enchilada sauce, drained white beans, drained corn, and the green chilies. Add the chili powder, garlic powder, cumin, smoked paprika, and oregano, then bring to a boil.

3

Simmer briefly

Reduce heat to maintain a gentle simmer with the lid slightly ajar for 5 minutes to meld flavors and heat canned ingredients through without overcooking.

4

Incorporate the cream cheese

Cut cream cheese into pieces and soften in the microwave in 20–30 second bursts until very soft. Stir into the simmering soup until fully melted and smooth, creating a creamy texture.

5

Add chicken and finish

Fold in 2 cups shredded cooked chicken and simmer an additional 5 minutes so the meat warms through and absorbs flavor. Taste and season with salt and pepper as needed.

6

Serve with toppings

Ladle soup into bowls and serve with desired toppings such as shredded cheese, chopped cilantro, avocado slices, lime wedges, and tortilla strips for crunch.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 320kcal | Carbohydrates: 28g | Protein:
25g | Fat: 14g | Saturated Fat: 4g |
Polyunsaturated Fat: 3g | Monounsaturated Fat:
6g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@paletina on social media!

Creamy Green Chicken Enchilada Soup

Categories:

Creamy Green Chicken Enchilada Soup

Did You Make This?

Leave a comment & rating below or tag @paletina on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Isabella!

Chef and recipe creator specializing in delicious Comfort Classics cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.